Protein Info for DZA65_RS03870 in Dickeya dianthicola ME23

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 27 to 280 (254 residues), 198.2 bits, see alignment E=2.8e-62 PF00532: Peripla_BP_1" amino acids 27 to 275 (249 residues), 62.2 bits, see alignment E=8.5e-21 PF13377: Peripla_BP_3" amino acids 148 to 290 (143 residues), 45.3 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 34% identical to RBSB_SALTY: Ribose import binding protein RbsB (rbsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 98% identity to dze:Dd1591_3338)

MetaCyc: 34% identical to ribose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D3E5 at UniProt or InterPro

Protein Sequence (312 amino acids)

>DZA65_RS03870 sugar ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKKITIMAAAMAFTMSSGLALAQNEQIVFSTPNLAMPFEVHMQRTAVKAAKELGVNLQVL
DSQGSSPKQVADLENAITRGAQGFVVSPNDVNAVSGAVTEIQDAKLPVVTLDRSVKTDKK
VPHFGANNYKGGQAIADFVKARFPNGADIVLLTGQPGSSSNIERTQGIRDGLKAGGSKYR
LVADQTGNWMRSEGMRIVESVLPSLPKRPQVILSANDDMALGAIEALQSQGLKPGEVMVT
GFDAVPEALARVRDGWLSATADQRPGYAVTQAMTQLTNNIRTKSPISGADYPPTMITKDN
LNDAERIGEAGK