Protein Info for DZA65_RS03855 in Dickeya dianthicola ME23

Annotation: CoA-acylating methylmalonate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR01722: methylmalonate-semialdehyde dehydrogenase (acylating)" amino acids 4 to 484 (481 residues), 678.8 bits, see alignment E=2e-208 PF00171: Aldedh" amino acids 16 to 480 (465 residues), 467.4 bits, see alignment E=2.2e-144

Best Hits

Swiss-Prot: 60% identical to BAUC_PSEAE: Putative 3-oxopropanoate dehydrogenase (bauC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00140, methylmalonate-semialdehyde dehydrogenase [EC: 1.2.1.27] (inferred from 94% identity to ddc:Dd586_0706)

Predicted SEED Role

"Methylmalonate-semialdehyde dehydrogenase [inositol] (EC 1.2.1.27)" in subsystem Inositol catabolism (EC 1.2.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTN0 at UniProt or InterPro

Protein Sequence (503 amino acids)

>DZA65_RS03855 CoA-acylating methylmalonate-semialdehyde dehydrogenase (Dickeya dianthicola ME23)
METVSNFIHGEVAPSHSARIAPVFNPATGEPIRQVALSSADEVKQAISAAAAAFPDWAKH
SPLRRARILFRFKALLEANLSALARQISEEHGKVYSDAVGELTRGLEVVEFACGIPHLQK
GEHSANIGTGVDSHSLMQPLGVCVGITPFNFPAMVPMWMFPIALATGNTFVLKPSEKDPS
LSLLLATLLKEAGLPDGVFNVVQGDKEAVDVLLTDPRVQAVSFVGSTPVAEYIYRTASAH
GKRCQALGGAKNHCILMPDADMDMAAGAILGAAFGAAGERCMALSVAVAVGDDTAEALCR
KLEQQVAAMRVGPGLTDGKENDMGPVISGAHRDKITGYIQSGIDQGATLRVDGRGLRVPG
HEQGYFIGPTLFDHVTPDMHIYREEIFGPVLAVVRVPDYQTALTLINQHEYGNGTAIFTR
DGETARQFSEEVQAGMVGINVPIPVPMAFHSFGGWKRSIFGPLNVYGNDGVRFYTRMKTV
TSRWPASVRLEQHASSFVMPTLE