Protein Info for DZA65_RS03630 in Dickeya dianthicola ME23

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 185 (185 residues), 63.6 bits, E=6e-21
• PF01370: Epimerase
  • amino acids 3 to 219 (217 residues), 127.3 bits, E=2.3e-40
• PF01073: 3Beta_HSD
  • amino acids 4 to 255 (252 residues), 72.9 bits, E=8.1e-24
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 303 (300 residues), 48.9 bits, E=2.3e-16
• PF13460: NAD_binding_10
  • amino acids 7 to 167 (161 residues), 54.6 bits, E=4.6e-18
• PF07993: NAD_binding_4
  • amino acids 51 to 184 (134 residues), 55.8 bits, E=1.4e-18
• PF02719: Polysacc_synt_2
  • amino acids 55 to 246 (192 residues), 23.1 bits, E=1.4e-08

Best Hits

Swiss-Prot: 51% identical to GALE_VIBCL: UDP-glucose 4-epimerase (galE) from Vibrio cholerae

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_02273)

MetaCyc: 55% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• stachyose degradation (7/7 steps found)
• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-α-D-quinovosamine biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Sequence Analysis Tools

See A0A385XVD6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>DZA65_RS03630 NAD-dependent epimerase/dehydratase family protein (Dickeya dianthicola ME23)
MKILITGSRGFIGRRLAALAGEQGITCVLHCSERADVSDSSMIRANLTAATDWMPALQGV
DAVVHCAARVHQMQDGGEALQLYRETNVAGTVRLAQQAAQAGVKRFVFLSSIKVNGELTQ
PGRPFQPEVVVPPADPYGLSKYEAEQALLRLARETGLEVVIIRPPLVYGPGAKANFRAMM
NWVNKGVPLPLAAVHNQRSLVFVDNLVDLILLSVRHPQAPGRVWLASDDHDVSTADLLAD
MAAALGVKNRCWPLPPWVLKSAAALLGKSAVAERLLGSLQVDIRETRQRLGWQPAVPYHQ
AIAATARAFLAETSGVSESVSKQG