Protein Info for DZA65_RS03510 in Dickeya dianthicola ME23

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 65 (28 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details PF01810: LysE" amino acids 14 to 213 (200 residues), 90.7 bits, see alignment E=4.5e-30

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 95% identity to ddd:Dda3937_02286)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C7I7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DZA65_RS03510 LysE family transporter (Dickeya dianthicola ME23)
MLLVMLSGLLLSLSLCLDLGIVNTAIINRGIRDGAGAAFFIGLGSCFGDLIYATLSVLGM
AVIFNYTPVRWLLWIGGGGVLLWLSFSMARSAWRDYRQHRGLPIDTVTVFSPRAPAPAHR
DFISGMGMALASPSALLWFAAIGGTLIAQATDGSARQVALFLSGFFIGGVLWTLFMALLI
QYGRGALKGRLSFYCSALSSVLFAVFAAQVIVNGYQTLLTPAN