Protein Info for DZA65_RS03490 in Dickeya dianthicola ME23

Annotation: bifunctional protein-disulfide isomerase/oxidoreductase DsbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10411: DsbC_N" amino acids 18 to 85 (68 residues), 71 bits, see alignment E=7.4e-24 PF13098: Thioredoxin_2" amino acids 104 to 227 (124 residues), 90 bits, see alignment E=1.8e-29

Best Hits

Swiss-Prot: 98% identical to DSBC_DICD3: Thiol:disulfide interchange protein DsbC (dsbC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03981, thiol:disulfide interchange protein DsbC [EC: 5.3.4.1] (inferred from 98% identity to ddd:Dda3937_02295)

MetaCyc: 64% identical to protein disulfide isomerase DsbC (Escherichia coli K-12 substr. MG1655)
Protein disulfide-isomerase. [EC: 5.3.4.1]

Predicted SEED Role

"Thiol:disulfide interchange protein DsbC" in subsystem Periplasmic disulfide interchange

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8A1 at UniProt or InterPro

Protein Sequence (238 amino acids)

>DZA65_RS03490 bifunctional protein-disulfide isomerase/oxidoreductase DsbC (Dickeya dianthicola ME23)
MKKRVVLFSLLTLALSGVARADDAVIKQTLNRLGLQNAEVKDSPIGGIKTVLTENGVLYI
TEDGKHLLQGPLYDVSGKTPVNVTNHILNDRLDALKDQMIVYKAPQEKHVITVFTDITCG
YCHKLHEQIKDYNALGITVRYLAYPRQGMNSQAAKDMQSIWCVADRNKAFDAAMKGDDVS
PATCKTDIGSHYQLGVLFGVQGTPAIVLDDGTVVPGYQPPKEMMAMLDAHKASLKSGG