Protein Info for DZA65_RS03425 in Dickeya dianthicola ME23

Annotation: acetolactate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR01252: alpha-acetolactate decarboxylase" amino acids 31 to 259 (229 residues), 295.4 bits, see alignment E=1.3e-92 PF03306: AAL_decarboxy" amino acids 32 to 249 (218 residues), 280.9 bits, see alignment E=3e-88

Best Hits

Swiss-Prot: 64% identical to ALDC_KLEAE: Alpha-acetolactate decarboxylase (budA) from Klebsiella aerogenes

KEGG orthology group: K01575, acetolactate decarboxylase [EC: 4.1.1.5] (inferred from 97% identity to ddd:Dda3937_02311)

MetaCyc: 64% identical to alpha-acetolactate decarboxylase (Klebsiella aerogenes)
Acetolactate decarboxylase. [EC: 4.1.1.5]

Predicted SEED Role

"Alpha-acetolactate decarboxylase (EC 4.1.1.5)" in subsystem Acetoin, butanediol metabolism or Alpha-acetolactate operon (EC 4.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT75 at UniProt or InterPro

Protein Sequence (262 amino acids)

>DZA65_RS03425 acetolactate decarboxylase (Dickeya dianthicola ME23)
MDMKDVNCVDPCVRELTSFALHHQKQHPECVIYQTSLMSGLINGVYEGNITMEELLKHGD
FGLGTFNDLDGELVALNSRIFQLREDGSARAALPYQKTPFAVMTFFRPTEQIRFGQAASR
ETIHQRINDLIATDNLFCALRIDGRFSHVETRTVPRQERPYKPMLEAIAQQPTFHFEQCQ
GSVVGFRSPAYVQGINVAGYHEHFITDDRKGGGHILDYRLEEGVLTFGSIAKLVIDLPRD
RDFLKANLSPEDLDSVIHSVES