Protein Info for DZA65_RS03415 in Dickeya dianthicola ME23

Annotation: DUF1435 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 39 (16 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details PF07256: DUF1435" amino acids 18 to 90 (73 residues), 104.5 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddc:Dd586_0622)

Predicted SEED Role

"FIG00613280: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CBT0 at UniProt or InterPro

Protein Sequence (94 amino acids)

>DZA65_RS03415 DUF1435 domain-containing protein (Dickeya dianthicola ME23)
MLTAMIAACGLWGISWYFGKRLSSAWGILLPAALMPLLALPELSLTHLKYICALAMLITL
SMLFHRRMRHYLLLPSCIALAGGLAALSLTLKGW