Protein Info for DZA65_RS03380 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit psi

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF03603: DNA_III_psi" amino acids 3 to 129 (127 residues), 162 bits, see alignment E=4e-52

Best Hits

Swiss-Prot: 57% identical to HOLD_ECOLI: DNA polymerase III subunit psi (holD) from Escherichia coli (strain K12)

KEGG orthology group: K02344, DNA polymerase III subunit psi [EC: 2.7.7.7] (inferred from 93% identity to ddc:Dd586_0618)

MetaCyc: 57% identical to DNA polymerase III subunit psi (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III psi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XV97 at UniProt or InterPro

Protein Sequence (139 amino acids)

>DZA65_RS03380 DNA polymerase III subunit psi (Dickeya dianthicola ME23)
MTSRRDWLLQQLGITQWTLRRPSALKGEIAVSLPPDARLLIIADPLPASDDPLLQDVMRS
LNLSSQQIVSLTPRQAQMLPEHTRCHSWWLGPPVTDPLALDGVQLTSPALAELYHNAGAK
RALWQQICHHEHDFYPDRG