Protein Info for DZA65_RS03375 in Dickeya dianthicola ME23

Annotation: ribosomal protein S18-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF13420: Acetyltransf_4" amino acids 11 to 134 (124 residues), 33.6 bits, see alignment E=1.1e-11 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 11 to 142 (132 residues), 140.2 bits, see alignment E=2.2e-45 PF00583: Acetyltransf_1" amino acids 15 to 120 (106 residues), 70.6 bits, see alignment E=4.2e-23 PF13673: Acetyltransf_10" amino acids 37 to 125 (89 residues), 43.4 bits, see alignment E=9.8e-15 PF12746: GNAT_acetyltran" amino acids 45 to 122 (78 residues), 27.5 bits, see alignment E=6.9e-10 PF13508: Acetyltransf_7" amino acids 47 to 121 (75 residues), 52.3 bits, see alignment E=1.9e-17 PF08445: FR47" amino acids 57 to 123 (67 residues), 43.8 bits, see alignment E=6.4e-15

Best Hits

Swiss-Prot: 70% identical to RIMI_SALTY: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 92% identity to ddd:Dda3937_02319)

MetaCyc: 68% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CBP2 at UniProt or InterPro

Protein Sequence (147 amino acids)

>DZA65_RS03375 ribosomal protein S18-alanine N-acetyltransferase (Dickeya dianthicola ME23)
MNMISTLTAADLPRAFEIECVSHTVPWSEKTFISNQGERYLNLKLCHDQQLVAYAITQVV
LDEATLFNITVAPDHQRHGYGRQLLEHLIAELEHRGILTLWLEVRASNVRAIALYQSMGF
NDVSVRRDYYPTANGREDAIIMALPLG