Protein Info for DZA65_RS03330 in Dickeya dianthicola ME23

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 257 to 274 (18 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details PF00892: EamA" amino acids 165 to 293 (129 residues), 30 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: None (inferred from 70% identity to dda:Dd703_2163)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CG37 at UniProt or InterPro

Protein Sequence (310 amino acids)

>DZA65_RS03330 EamA family transporter (Dickeya dianthicola ME23)
MKTNILSAGVVSGVIFCGISAAFDVFVANITQNLEPAVFIVYCFIISTVVFLTIGTFKNG
TSYLDKAKRSIPLLSLVNTAVLLNWGGLIFALKYLEPAVVGIASVACGPALTIVISRYFI
RGASTPDKAESSIAWIILFGVIVMLINSYFGKSGVINTSYFERTTGIICVICSAIGTVLY
TFYSKDLSKKGWKSYEILGFRNILMLLVALGYCAYNNIYFYLTENLLLIVIVLSVIGHVI
PIFLIQKSISTLDPIHVSLLLLLLPVFTLALQFFDDRIFISWESISAVFAITFFLIFLCV
TKIHAGKKGV