Protein Info for DZA65_RS03275 in Dickeya dianthicola ME23

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 178 to 188 (11 residues), see Phobius details TIGR03558: luciferase family oxidoreductase, group 1" amino acids 7 to 327 (321 residues), 461.5 bits, see alignment E=7.6e-143 PF00296: Bac_luciferase" amino acids 9 to 304 (296 residues), 132 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 68% identical to YHBW_ECOL6: Luciferase-like monooxygenase (yhbW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 95% identity to ddd:Dda3937_02334)

Predicted SEED Role

"FIG00613475: hypothetical protein"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.3

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTX6 at UniProt or InterPro

Protein Sequence (339 amino acids)

>DZA65_RS03275 LLM class flavin-dependent oxidoreductase (Dickeya dianthicola ME23)
MTATVPFSLLDLAPIPQGNTARDAFHHSLDLAQHAEKWGYRRYWLAEHHNMTGIASAATS
VLIGYIAGGTQRIKLGSGGVMLPNHAPLVIAEQFGTLESLYPGRIELGLGRAPGTDPHTM
QALRRHLNADIDDFPHDVQELQRYFAPAQPGQAVQAVPGQGLNVPIWLLGSSLYSAQLAA
SMGLPFAFAAHFAPDMLLQALQLYRDNFQPSAQLEKPYTMVCVNVVAADSDRDARFLLTS
LQQQFINLRRGTPGPLPAPVESMETYWSAAEQFAVEQTLRLAVVGDAANVRHGLQTLLRE
TQADELMINGQIFDHQARLRSFELVAQLQPEIVREARIQ