Protein Info for DZA65_RS03245 in Dickeya dianthicola ME23

Annotation: tRNA pseudouridine(55) synthase TruB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 12 to 219 (208 residues), 291.4 bits, see alignment E=2e-91 PF01509: TruB_N" amino acids 33 to 180 (148 residues), 185.9 bits, see alignment E=8.6e-59 PF16198: TruB_C_2" amino acids 181 to 249 (69 residues), 74.8 bits, see alignment E=7.4e-25 PF09157: TruB-C_2" amino acids 252 to 309 (58 residues), 70 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 82% identical to TRUB_PECAS: tRNA pseudouridine synthase B (truB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 95% identity to ddd:Dda3937_02339)

MetaCyc: 74% identical to tRNA pseudouridine55 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11839 [EC: 5.4.99.25]

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWL3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DZA65_RS03245 tRNA pseudouridine(55) synthase TruB (Dickeya dianthicola ME23)
MSRPRRRGRDIHGVLLLDKPQGASSNDVLQKVKRLFNANKAGHTGALDPLATGMLPVCLG
EATKFSQYLLDADKRYRVIARLGLRTDTSDADGNVIQERLITFTRDLLMQALDGFRGDTK
QVPSMYSALKYQGRPLYEYARQGLVVPREARDITVYELQFIRWEGDELELEIHCSKGTYI
RTIIDDLGEKLGCGAHVIYLRRLQVATYPTERMVTLEQLQALREQAEAQEQPIGELLDVL
LLPMDTAVQAFAEVNLSPVVAGYLKLGQAVRAAATSADGMVRITEGDERRFIGMGEIDDE
GRVAPRRLVVENPVPADA