Protein Info for DZA65_RS03190 in Dickeya dianthicola ME23

Annotation: 23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR00438: ribosomal RNA large subunit methyltransferase J" amino acids 20 to 206 (187 residues), 308.6 bits, see alignment E=6.6e-97 PF01728: FtsJ" amino acids 32 to 207 (176 residues), 199.6 bits, see alignment E=2.2e-63

Best Hits

Swiss-Prot: 92% identical to RLME_SALTI: Ribosomal RNA large subunit methyltransferase E (rlmE) from Salmonella typhi

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 98% identity to ddd:Dda3937_02348)

MetaCyc: 91% identical to 23S rRNA 2'-O-ribose U2552 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11845 [EC: 2.1.1.166]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.166

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXX0 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DZA65_RS03190 23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE (Dickeya dianthicola ME23)
MANKKRSASSTRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQTDRLFKPGMTVVDLGA
APGGWSQYVVSQNGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVLKTLLERVGAEKVQV
VMSDMAPNMSGTPAVDIPRAMYLVELALDMCRDILAPGGSFVVKVFQGVGFDEYLREIRS
LFATVKIRKPDASRARSREVYIVATGRKL