Protein Info for DZA65_RS03145 in Dickeya dianthicola ME23

Annotation: putative DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF07037: YfeC-like" amino acids 7 to 113 (107 residues), 33.2 bits, see alignment E=6e-12 PF02316: HTH_Tnp_Mu_1" amino acids 10 to 86 (77 residues), 55.5 bits, see alignment E=7.7e-19

Best Hits

KEGG orthology group: None (inferred from 85% identity to dze:Dd1591_3482)

Predicted SEED Role

"FIG01220305: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT39 at UniProt or InterPro

Protein Sequence (124 amino acids)

>DZA65_RS03145 putative DNA-binding transcriptional regulator (Dickeya dianthicola ME23)
MEKAWFTTNELLGVAGLPKSRQGLNKRAKENGWEKRRRKGVQGKGVEYAIWSLPTEVKTT
LMQETAPDYAGKSATVQEHTWVQIYHQLSAEERTRLIGHILREGVMGMLARLENGPQEYK
NKGE