Protein Info for DZA65_RS03135 in Dickeya dianthicola ME23

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF13693: HTH_35" amino acids 7 to 81 (75 residues), 128 bits, see alignment E=5.9e-42

Best Hits

Swiss-Prot: 67% identical to SFSB_ECO57: Sugar fermentation stimulation protein B (sfsB) from Escherichia coli O157:H7

KEGG orthology group: K07724, Ner family transcriptional regulator (inferred from 99% identity to ddd:Dda3937_03528)

Predicted SEED Role

"Ner-like regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CES6 at UniProt or InterPro

Protein Sequence (93 amino acids)

>DZA65_RS03135 transcriptional regulator (Dickeya dianthicola ME23)
MNSRKNDWHPADIIAALRKKGTTLAAVSRAAGLSSSTLANALSRPWPKGEWLIADALGIH
PSEIWPSRYYDPETQELLDRKKLIRPQSDPQSE