Protein Info for DZA65_RS03120 in Dickeya dianthicola ME23

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 313 (311 residues), 444.6 bits, see alignment E=1.8e-137 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 306 (303 residues), 416 bits, see alignment E=9e-129 PF00814: TsaD" amino acids 24 to 307 (284 residues), 328 bits, see alignment E=5.7e-102 PF22521: HypF_C_2" amino acids 221 to 302 (82 residues), 34.3 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 90% identical to TSAD_PECAS: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 97% identity to ddd:Dda3937_03531)

MetaCyc: 87% identical to N6-L-threonylcarbamoyladenine synthase, TsaD subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234 or 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D9W6 at UniProt or InterPro

Protein Sequence (337 amino acids)

>DZA65_RS03120 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD (Dickeya dianthicola ME23)
MRVLGIETSCDETGVAIYDTQAGLLANQLYSQVTLHADYGGVVPELASRDHVRKTVPLIQ
AALKEAGLQRSEIDGVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPM
LEDNPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAGEAFDKTAKLLGLDYPGG
PLLSKMAQNGHSKRFVFPRPMTDRPGLDFSFSGLKTFAANTIRENGSDAQTQADIARAFE
DAVVDTLAIKCRRALDDTGFSRLVMAGGVSANRTLRQRLADIMAKRGGDVFYARPEFCTD
NGAMIAYAGAVRLAQGVTDELGITVRPRWPLAELPAL