Protein Info for DZA65_RS03065 in Dickeya dianthicola ME23

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 6 to 194 (189 residues), 137.6 bits, see alignment E=5.8e-44 PF08659: KR" amino acids 7 to 160 (154 residues), 36.6 bits, see alignment E=6.9e-13 PF13561: adh_short_C2" amino acids 11 to 193 (183 residues), 90.5 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 79% identity to dze:Dd1591_3491)

Predicted SEED Role

"Probable short-chain dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT79 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DZA65_RS03065 SDR family oxidoreductase (Dickeya dianthicola ME23)
MDTTPAVLITGASSGIGAVYAERFAHRGHDLVLVARDSTRMDALAVRLHQDYGVTVDVLP
ADLTQPDELAVVETRLREDSHIGILVNNADMSIAGNFLEQATNDIGRLVALNTVALVRLA
SAVAPRLAAAGEGAIINIGSVVGLAPEFGATVYGATKAFVLFLSQGLSLELAPCGVYVQA
VLPAATRTESGERSGTDINTLPPVMEAEELVDAALVGFDRREPVTIPPLHEFGQWEAYQH
ARQAMLPGFAQANTDARYRLMHSPILNCVRSAPVLFTQATDSLMVNQ