Protein Info for DZA65_RS03010 in Dickeya dianthicola ME23

Annotation: pectate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00544: Pectate_lyase_4" amino acids 11 to 308 (298 residues), 227.2 bits, see alignment E=1.6e-71

Best Hits

Swiss-Prot: 60% identical to PELD_PSEMA: Pectin lyase (pnl) from Pseudomonas marginalis

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_03551)

Predicted SEED Role

"Pectin lyase (EC 4.2.2.10)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.2.10)

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.10

Use Curated BLAST to search for 4.2.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT25 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DZA65_RS03010 pectate lyase (Dickeya dianthicola ME23)
MAYPTTGTSGMVGFATSGSTTGGKGGTVVSITSLNDLKTHVAGTDTKILVINANISASSL
TKVTLGANKSIIGSYSSNTLTNIHFRSSSSSKNIIFQNLTFKHTSTINGNDDIQIYLTHG
NKYWLDHLTFPGHDYTLTDGGLDKLIYIGEKADYVTISNCLFKNHEYGLILGYPQDGSSN
GSTYDGYPHLTICHCYFSNIYVRAPGLMRYGYYHAYNNFIDKYQLGFTLAQNAKIVSEYN
YFGTTTSSNKGMLDDKGTGTFTDTGSTPSITNQTSSASKWTPSSNYSYTLKTVSEAKTFT
QKYAGAQSASLTFGG