Protein Info for DZA65_RS03000 in Dickeya dianthicola ME23

Annotation: 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF26049: RLMG_N" amino acids 1 to 180 (180 residues), 239.8 bits, see alignment E=2.7e-75 PF05175: MTS" amino acids 226 to 397 (172 residues), 169.7 bits, see alignment E=6.3e-54 PF06325: PrmA" amino acids 256 to 332 (77 residues), 25.4 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 91% identity to ddd:Dda3937_03553)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTS2 at UniProt or InterPro

Protein Sequence (404 amino acids)

>DZA65_RS03000 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG (Dickeya dianthicola ME23)
MSQLFLETHRLTLVRYPQSERESTLQAWEAADEYLLRELALMPIGPGPRLIFNDAFGALA
CGLQAQAPCCISDSYLSQLATRHNLSLNGYAPESVTLHDSLAPLPDAPALVVLKVPKTLA
LLEHQLRQLREVVTPQTVIIAGAKARDIHTSTLQLFEQILGPTHTSLAWKKARLVHCRPE
PRVIDEQPRAIDEQPRAIDQQPQAIDEQPPMSVWTLDDADSPIHNYRIHNYANVFARSGL
DIGARFFIQHLPQQLDGKIVDLGCGNGIIGLTALAQNPQAYVSFFDESYMAVASSQRNVE
VNRPQDMVRSSFVVNHALAGVGQDSLQAVLCNPPFHQQQAITDDIAWQMFLDARRCLAVG
GELRIVGNRHLDYFHKLKRLFGNCENVASNAKFGVLRAVKTHSR