Protein Info for DZA65_RS02950 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 286 (271 residues), 164.7 bits, see alignment E=1.5e-52 amino acids 301 to 424 (124 residues), 38.5 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 85% identical to EXUT_ECO57: Hexuronate transporter (exuT) from Escherichia coli O157:H7

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 96% identity to dze:Dd1591_3512)

MetaCyc: 85% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C9B6 at UniProt or InterPro

Protein Sequence (433 amino acids)

>DZA65_RS02950 MFS transporter (Dickeya dianthicola ME23)
MFKIKGLRWYMIGLVTIGTVLGYLTRNAIAAAAPTLQEQLHISTQQYSYIIAAYSACYTV
MQPVAGYVLDMLGTKVGYAMFAVLWALFCAGTALANSWGGLAIARGAVGMAEAAMIPAGL
KASSEWFPAKERSVAVGYFNVGSSIGGMLAPPLVVWAIMAHSWQMAFLITGALSLVWALC
WLYFYKHPKDQKKLSAEERDYILSGQEAQHQSGNAKKLSAWQILRNRQFWGIALPRFLAE
PAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADLGCILGGYMPMMFQKYFKVNLIV
SRKLVVTLGALLMIGPGTIGLFTSPYVAIALLCVGGFAHQSLSGALITLSSDVFGRNEVA
TANGLTGMAAWTASTLFALVVGALADTIGFSPLFAVLAIFDLLGAVVIWTVLKNHPVSEG
GDKGADLKAAQQH