Protein Info for DZA65_RS02940 in Dickeya dianthicola ME23

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 24 to 61 (38 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details PF09335: VTT_dom" amino acids 48 to 172 (125 residues), 66.9 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 77% identical to YQJA_SHIFL: Inner membrane protein YqjA (yqjA) from Shigella flexneri

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_02736)

Predicted SEED Role

"DedA family inner membrane protein YqjA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH07 at UniProt or InterPro

Protein Sequence (225 amino acids)

>DZA65_RS02940 DedA family protein (Dickeya dianthicola ME23)
MDIVKELLFALWHQNFEVLANPKLVWTIYLLLFLILFLENGLLPAAFLPGDSLLILVGVL
VAKGTMNYPFTIALLTTAASLGCWVSYLQGKWLGNTRVVQGWLSHLPSHYHQRAHQLFHR
HGLSALLIGRFLAFVRTLLPTIAGLSGLNNTRFQFFNWMSGFLWVIILVSLGFALGNTPI
FRKYENQLMSCLMLLPLVLLFLGLAGSLLVLWRKKRMTARKKGID