Protein Info for DZA65_RS02845 in Dickeya dianthicola ME23

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 329 to 346 (18 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 433 (429 residues), 657 bits, see alignment E=7.5e-202 PF03605: DcuA_DcuB" amino acids 5 to 365 (361 residues), 527.3 bits, see alignment E=9.7e-163

Best Hits

Swiss-Prot: 69% identical to DCUA_WOLSU: Anaerobic C4-dicarboxylate transporter DcuA (dcuA) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K07791, anaerobic C4-dicarboxylate transporter DcuA (inferred from 97% identity to dze:Dd1591_3533)

MetaCyc: 64% identical to C4-dicarboxylate transporter DcuA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN-379

Predicted SEED Role

"C4-dicarboxylate transporter DcuA"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CAC6 at UniProt or InterPro

Protein Sequence (433 amino acids)

>DZA65_RS02845 anaerobic C4-dicarboxylate transporter (Dickeya dianthicola ME23)
MVILELFIVLLAIYLGARLGGIGIGFAGGLGVLVLTLGFHIKPGAIPFDVIEIIMAVIAA
IAAMQVAGGMDYLVSLAEKLLRRQPRYVTFLAPLVTYFMTLLAGTGHTAFSTLPVIAEVA
KEQGIRPSRPLSIAVVASQIAITASPISAAVVFVAGILEPKGVSYLALLGICIPSTLTAI
LLTAILTNFLGKELKDDEIYQERLRKGEVSLRGHGQQALKPGAKRSVGLFLVGIIAVVLY
ATAISDTVGLIHNPVLPRNEAIVVFMLTIATLICLTCRVDTAQILSASTFKSGMSACVCV
MGVAWLGDTFVKAHIADIQSTAGALLQNHPWMLAVVLFFAATLLYSQAATAKALMPAALL
LGVSPVTAIASFAAVSALFVLPTYPTLLAAVEMDDTGSTRIGKYVFNHAFLIPGVVAISL
SVVFGFVIGHLVL