Protein Info for DZA65_RS02740 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF13579: Glyco_trans_4_4" amino acids 14 to 216 (203 residues), 39 bits, see alignment E=2.6e-13 PF13439: Glyco_transf_4" amino acids 14 to 220 (207 residues), 59.7 bits, see alignment E=9.4e-20 PF00534: Glycos_transf_1" amino acids 225 to 378 (154 residues), 106 bits, see alignment E=4.2e-34 PF13692: Glyco_trans_1_4" amino acids 231 to 361 (131 residues), 95.1 bits, see alignment E=1.2e-30 PF13524: Glyco_trans_1_2" amino acids 251 to 393 (143 residues), 37 bits, see alignment E=7.9e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to pwa:Pecwa_0591)

Predicted SEED Role

"Putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWC7 at UniProt or InterPro

Protein Sequence (403 amino acids)

>DZA65_RS02740 glycosyltransferase family 4 protein (Dickeya dianthicola ME23)
MKVLLVNKFFYIKGGAETVYFQEIDMLKKAGVEVIAFSMQHEDNFPSDYAPYFVDNVDYH
QNGSMTGKIKTAVNFIHNAQACNKLLALLRKEKPDIVHFHNIYHQLTPSLINIARQFGCK
TVLTAHDYKIVCPSYTMLRDGKVCDACLTGSVFNAFKYRCQQGSASKSLLLSLEGAWQNI
AKNYQALDVIVSPSEFLRSQLIRKLPNTRIDVIVNGINDSLPVEEVEDEGYLLFIGRLSR
EKGVATLARAHQQMRNNIPLKIAGSGPLYHDLVAQFPNAEFLGYQQQGEELNRLIKHARA
VVVPSEYYENCSMSVLESMAFAKPVVGGRIGGIPEQIRDNVDGVLFEPGNVQALADVLDD
LALNPQKAREMGLNARQRLREKYSLHKHTEALLALYQEIVNEK