Protein Info for DZA65_RS02725 in Dickeya dianthicola ME23

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 207 to 256 (50 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 347 to 364 (18 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 94% identity to eca:ECA0503)

Predicted SEED Role

"O-antigen flippase Wzx" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQN0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>DZA65_RS02725 capsular polysaccharide biosynthesis protein (Dickeya dianthicola ME23)
MSLLKSVSTIAGSSVVSQLIGALSIWLISHKYNMAEVGIYALSYSIVLVGAQVCTFASQL
LIPKQQDSELAQSVVFSTLQSLLTAVPYALLTAWLFQRNVFFLYLLTLSYALVLISENLS
LRAGNYRFLAFQRLAVSAVVVLSLVFTSHTATFYWSWACAMMVLISGCILHSFTIHTITL
RNFSLQRNMAFFHQHVHHLTRVGSAEVLAMVNNNLPVMLINFWFSALTAGYFSVVSRFCL
APVVIIGNAVRNSIFATWSADFRNKRFNYAEFKKVRLVLLMSGTVCTLGVFIFYPLVMHL
FFSEEWINSIPTSRYMLPYLFPALAVCPLTVIELIFGSHRYFLRIQLEQLSIVLISFVIV
PYFYNHYATSIILFSVLTFVRYAFIYLKVNKRANGLKNMMSES