Protein Info for DZA65_RS02715 in Dickeya dianthicola ME23

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02563: Poly_export" amino acids 34 to 107 (74 residues), 71.9 bits, see alignment E=4e-24 PF10531: SLBB" amino acids 112 to 154 (43 residues), 41.4 bits, see alignment 1e-14

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 93% identity to ddd:Dda3937_02644)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsC, polysaccharide export"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D019 at UniProt or InterPro

Protein Sequence (185 amino acids)

>DZA65_RS02715 capsular polysaccharide biosynthesis protein (Dickeya dianthicola ME23)
MKIIKLCIFLCLSVWLAGCTLSNPRQMDKPDNGTTGYQLDEGDSVNILVYGEPEMAMTFM
LDKSGEITFPYIGQLVLKGKTPGQVGEELANRLRGDYLQNPMVTVSIAEFRKFYITGEVV
KPNGYAYEPGLTVEKSLALAGGFTDRADRKDVSIRLSNSNQLIENVDVRHAVHPGDTVIV
GMSFF