Protein Info for DZA65_RS02685 in Dickeya dianthicola ME23

Annotation: Cd(II)/Pb(II)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF13411: MerR_1" amino acids 1 to 67 (67 residues), 68.5 bits, see alignment E=6.5e-23 TIGR02047: Cd(II)/Pb(II)-responsive transcriptional regulator" amino acids 1 to 127 (127 residues), 172 bits, see alignment E=2.7e-55 PF00376: MerR" amino acids 2 to 39 (38 residues), 60.8 bits, see alignment E=1.4e-20 PF09278: MerR-DNA-bind" amino acids 44 to 107 (64 residues), 69.9 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 36% identical to ZNTR_ECO57: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02649)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSQ6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>DZA65_RS02685 Cd(II)/Pb(II)-responsive transcriptional regulator (Dickeya dianthicola ME23)
MKIGDLAKATNSTPETIRFYEKKGLLPEPERTEGNYRHYYQFHVDRLRFIRNCRSLDMNH
DEIRALIALSEQPAASCEGVNVLLNEHLGHVEARIAELQQLKAQLMHISRRCQVTQTVDG
CGILHGLSALEPEDSGAGHTHLG