Protein Info for DZA65_RS02655 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00583: Acetyltransf_1" amino acids 88 to 185 (98 residues), 36.3 bits, see alignment E=9.4e-13 PF13508: Acetyltransf_7" amino acids 104 to 186 (83 residues), 33 bits, see alignment E=9.6e-12 PF08445: FR47" amino acids 133 to 188 (56 residues), 23.7 bits, see alignment E=5.9e-09

Best Hits

KEGG orthology group: None (inferred from 68% identity to pam:PANA_0318)

Predicted SEED Role

"probable acetyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTL7 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DZA65_RS02655 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MTASEGVIRLARESDNAALYDICLKTANAGGDASSLYSDPQYPGQRFSVPYLYFAAPFAF
VLEQASQVTGYVVAAPDTVLFEEALAQHWWPRWQDAYRDRQAQAERDDDILGAIRQPERA
AAQLTSAWPAHLHINLLPSAQGGGWGRRMVETELRALREAGVKGVHLGVSLQNEAVCAFY
QRLGFRHVVRSHAIYMARTL