Protein Info for DZA65_RS02650 in Dickeya dianthicola ME23

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF01547: SBP_bac_1" amino acids 47 to 348 (302 residues), 105.5 bits, see alignment E=8.6e-34 PF13416: SBP_bac_8" amino acids 52 to 364 (313 residues), 99.6 bits, see alignment E=4.3e-32 PF13343: SBP_bac_6" amino acids 275 to 387 (113 residues), 27.2 bits, see alignment E=4e-10

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 74% identity to pao:Pat9b_0370)

Predicted SEED Role

"probable sugar ABC transporter, substrate-binding protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT08 at UniProt or InterPro

Protein Sequence (442 amino acids)

>DZA65_RS02650 extracellular solute-binding protein (Dickeya dianthicola ME23)
MISPCSRTSIRRNALPALIGAITSLFMVAAQSTTFSEWDIYSYPEQSKAVEKAISTFTAE
HPGITIQRSVHSFEDTRIPLKLALTSGDGPQVAQVNQGGGDMGALVKDKLLYPLDDYAKQ
YGWTTRFPDSILQRNRWSDKQDFGSGTLYGVASLGEMIGLYYNKALLDKAGIAVPQTLPE
LEKAMATLKAKGIPPLMLGLLDGNMGQQLLSTLWETHIDSANRKPLDALIYGVGGTFNDP
RLLKAAGIMQDWNQKGYFFPGFQGIGHDDAATLFQNGQSAFLISGTWYLGQFKQNKDIHF
ATIPHAEGVNHALMVGGTDLAYSITNMAKTKEQRDDAAKFIDYIVSDSMANLWLQAGFLP
AGTDKNAAIPKDNPLLEEAYHTWVDLNAYDGLGHYVDWATPTMNTTLNQNVQLLLANRLT
PAQLVANLDSDYANYMKSLKKP