Protein Info for DZA65_RS02585 in Dickeya dianthicola ME23

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 2 to 110 (109 residues), 105.7 bits, E=8.9e-35
• PF00576: Transthyretin
  • amino acids 4 to 109 (106 residues), 104.2 bits, E=2.8e-34

Best Hits

Swiss-Prot: 38% identical to HIUH_SALDU: 5-hydroxyisourate hydrolase (hiuH) from Salmonella dublin

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 94% identity to ddd:Dda3937_02652)

Predicted SEED Role

"5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17)" (EC 3.5.2.17)

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• urate conversion to allantoin III (2/3 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

See A0A3A4D313 at UniProt or InterPro

Protein Sequence (110 amino acids)

>DZA65_RS02585 hydroxyisourate hydrolase (Dickeya dianthicola ME23)
MSTLSTHILDTALGQPAAGVLVLLERRVHDSWQPVARHHTNDDGRIASFTPDPLPAGHYR
LTADIGRWFAAGNRDALYISAQIDVRLVDVGHYHLPFLISPWSWSTYRGS