Protein Info for DZA65_RS02570 in Dickeya dianthicola ME23

Annotation: alkyl hydroperoxide reductase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 517 (517 residues), 793 bits, see alignment E=5.6e-243 PF13192: Thioredoxin_3" amino acids 126 to 192 (67 residues), 31.6 bits, see alignment E=6.2e-11 PF07992: Pyr_redox_2" amino acids 213 to 504 (292 residues), 163.8 bits, see alignment E=2.8e-51 PF13738: Pyr_redox_3" amino acids 261 to 487 (227 residues), 55.5 bits, see alignment E=2.5e-18 PF00070: Pyr_redox" amino acids 357 to 431 (75 residues), 51 bits, see alignment E=7.5e-17

Best Hits

Swiss-Prot: 81% identical to AHPF_ECOLI: Alkyl hydroperoxide reductase subunit F (ahpF) from Escherichia coli (strain K12)

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 97% identity to ddd:Dda3937_02655)

MetaCyc: 81% identical to alkyl hydroperoxide reductase, AhpF component (Escherichia coli K-12 substr. MG1655)
RXN-8506 [EC: 1.5.1.37]; R4-RXN [EC: 1.5.1.37, 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.26 or 1.5.1.37 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSW0 at UniProt or InterPro

Protein Sequence (520 amino acids)

>DZA65_RS02570 alkyl hydroperoxide reductase subunit F (Dickeya dianthicola ME23)
MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTDIAGLSDKVSFFENNDLPV
RKPSFLITNPGAANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAQELLDQIRELDGKFH
FETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FGQGRMSLAEIVGKVDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETVSGAVLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRVTDSGHKLALEGIFVQIGLLPNTGWLDGAINRNRIGEIEIDARGETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA