Protein Info for DZA65_RS02485 in Dickeya dianthicola ME23

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00416: DNA repair protein RadA" amino acids 1 to 455 (455 residues), 772.6 bits, see alignment E=6.2e-237 PF18073: Zn_ribbon_LapB" amino acids 9 to 36 (28 residues), 41.3 bits, see alignment (E = 3.3e-14) PF23442: DUF7125" amino acids 77 to 189 (113 residues), 31.1 bits, see alignment E=5.7e-11 PF06745: ATPase" amino acids 79 to 152 (74 residues), 42.7 bits, see alignment E=1.6e-14 PF13481: AAA_25" amino acids 89 to 226 (138 residues), 51.1 bits, see alignment E=4.6e-17 PF13541: ChlI" amino acids 349 to 434 (86 residues), 36.8 bits, see alignment E=1.1e-12 PF05362: Lon_C" amino acids 356 to 437 (82 residues), 27.4 bits, see alignment E=8.5e-10

Best Hits

Swiss-Prot: 92% identical to RADA_SALTY: DNA repair protein RadA (radA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 99% identity to dze:Dd1591_3589)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSZ5 at UniProt or InterPro

Protein Sequence (461 amino acids)

>DZA65_RS02485 DNA repair protein RadA (Dickeya dianthicola ME23)
MAKAVKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLAAASSSSRSDRFSGYAGDSGN
VSRVQKLSEISLEALPRFSTGFQEFDRVLGGGVVPGSAILIGGNPGAGKSTLLLQTLCKL
AEQMKTLYVTGEESLQQVAMRAHRLGLPAQHINMLSETSIEQICLIAEQEQPKLMVIDSI
QVMHLADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVTKDGSLAGPKVLEHCIDC
SVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREISNPSAIFLSRGDEITSGSS
VMVVWEGTRPLLVEIQALVDHSMMANPRRVAVGLEQNRLAILLAVLHRHGGLQMSDQDVF
VNVVGGVKVTETSADLALLLSLVSSFRDRPLPQDLVVFGEVGLAGEIRPVPSGQERITEA
AKHGFKRAIVPFANMPKKPPANMQVMGVKKLSDALTILDDL