Protein Info for DZA65_RS02400 in Dickeya dianthicola ME23

Annotation: HTH-type transcriptional activator RhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 150 to 160 (11 residues), see Phobius details PF02311: AraC_binding" amino acids 24 to 129 (106 residues), 49.5 bits, see alignment E=5.7e-17 PF12833: HTH_18" amino acids 199 to 277 (79 residues), 82.4 bits, see alignment E=3.5e-27 PF00165: HTH_AraC" amino acids 242 to 276 (35 residues), 41.3 bits, see alignment 2e-14

Best Hits

Swiss-Prot: 79% identical to RHAR_PECAS: HTH-type transcriptional activator RhaR (rhaR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02854, AraC family transcriptional regulator, L-rhamnose operon transcriptional activator RhaR (inferred from 95% identity to dze:Dd1591_3607)

Predicted SEED Role

"L-rhamnose operon transcriptional activator RhaR" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTH6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>DZA65_RS02400 HTH-type transcriptional activator RhaR (Dickeya dianthicola ME23)
MPSRGLKLRAEDYFLTDKNTVTVAERSPQPAFPLHHHDFDELVIVWRGNGLHLWNDVPYR
VTCGDLFYVSARDRHSYESVHDLELDNILYTRERLTLLTDWQNLLPGGEVPQPQRYWRLA
AQSMDTLRDKVENLTQECMKSDPLSLQLSEVLLLQIALLALRYRYAPDSTQLADAQQLDL
LMNVLRASIARPFRLEDFCRLHGLSMRSLRSRFKQQTGMSVAQYLRQLRLCRAMELLRYN
RQTIGEVAAECGFDDSNYFSVVFHQAFGVTPSGYRQRFQAGGKV