Protein Info for DZA65_RS02400 in Dickeya dianthicola ME23
Annotation: HTH-type transcriptional activator RhaR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to RHAR_PECAS: HTH-type transcriptional activator RhaR (rhaR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K02854, AraC family transcriptional regulator, L-rhamnose operon transcriptional activator RhaR (inferred from 95% identity to dze:Dd1591_3607)Predicted SEED Role
"L-rhamnose operon transcriptional activator RhaR" in subsystem L-rhamnose utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XTH6 at UniProt or InterPro
Protein Sequence (284 amino acids)
>DZA65_RS02400 HTH-type transcriptional activator RhaR (Dickeya dianthicola ME23) MPSRGLKLRAEDYFLTDKNTVTVAERSPQPAFPLHHHDFDELVIVWRGNGLHLWNDVPYR VTCGDLFYVSARDRHSYESVHDLELDNILYTRERLTLLTDWQNLLPGGEVPQPQRYWRLA AQSMDTLRDKVENLTQECMKSDPLSLQLSEVLLLQIALLALRYRYAPDSTQLADAQQLDL LMNVLRASIARPFRLEDFCRLHGLSMRSLRSRFKQQTGMSVAQYLRQLRLCRAMELLRYN RQTIGEVAAECGFDDSNYFSVVFHQAFGVTPSGYRQRFQAGGKV