Protein Info for DZA65_RS02395 in Dickeya dianthicola ME23

Annotation: HTH-type transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF02311: AraC_binding" amino acids 18 to 153 (136 residues), 56.2 bits, see alignment E=4.7e-19 PF00165: HTH_AraC" amino acids 181 to 222 (42 residues), 34.1 bits, see alignment 3.6e-12 amino acids 233 to 271 (39 residues), 28.6 bits, see alignment 1.9e-10 PF12833: HTH_18" amino acids 194 to 272 (79 residues), 88.7 bits, see alignment E=3.7e-29

Best Hits

Swiss-Prot: 79% identical to RHAS_PECAS: HTH-type transcriptional activator RhaS (rhaS) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02855, AraC family transcriptional regulator, L-rhamnose operon regulatory protein RhaS (inferred from 94% identity to dze:Dd1591_3608)

Predicted SEED Role

"L-rhamnose operon regulatory protein RhaS" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTA7 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DZA65_RS02395 HTH-type transcriptional activator RhaS (Dickeya dianthicola ME23)
MTQLHGEEFFASQAATIAVEPRMPQCDFPDHYHDFWEIVLVEQGAGVHVFNDQPFALCSG
AVFFVRDNDRHLFEQVEALHLTNVLYRSPRGFRFLSDIAPFLPYGANGEWLGQWQVNAAA
QQQVKQLILQLAALAHHDQPEGIATSESLFLQILVLLRQKRFQTQGDGSEQLGIQALLGW
LQHNFCEEVDWETLADRFSLSLRTLHRQLKQRTGMTPQRYLNRLRLLEARCRLQHSDDSI
TTIAHDCGFSDSNHFSTQFRKAFALAPKTLRHQALT