Protein Info for DZA65_RS02325 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF12911: OppC_N" amino acids 26 to 77 (52 residues), 42.9 bits, see alignment 3.6e-15 PF00528: BPD_transp_1" amino acids 124 to 300 (177 residues), 68.7 bits, see alignment E=5.6e-23

Best Hits

Swiss-Prot: 37% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 97% identity to ddc:Dd586_0448)

MetaCyc: 39% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSU4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DZA65_RS02325 ABC transporter permease (Dickeya dianthicola ME23)
MKTAIARLAVIMKTAPPPGLLPEPGPWRRWQRKILGHHGMTLGLVILGAMVLLALLAPLI
SPHDPYAQDVSRRLIPPVWHDKGSWAHLLGTDKLGRDYLSRLLFGARVSLAIGLVSVMLA
GTIGIALGVLAGYFGGRVDAVVSYLLTVRLALPVILVALALASLVGGSVKVVIMLLGLLL
WDRFLIVSRSVTRQLREAEFIAAAQTLGASSLFIMLREILPNLLGPLTVVATLEIAHAVL
LEATLSFLGLGVQPPMPSWGLMVAEGKAYMFFQPWVIVIPGVVLALLVLSINLVGDGLRD
VTALDGRN