Protein Info for DZA65_RS02265 in Dickeya dianthicola ME23

Annotation: DUF2291 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF10054: DUF2291" amino acids 8 to 200 (193 residues), 156 bits, see alignment E=5.6e-50

Best Hits

KEGG orthology group: None (inferred from 91% identity to dze:Dd1591_3639)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTC5 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DZA65_RS02265 DUF2291 domain-containing protein (Dickeya dianthicola ME23)
MSRHVWLALAILGLGGCRIVSQQELADLRHPPNPHMANIGQTWQQKLVPQLVNEARPLAA
LMKDLQSSSDMDAACKQFGYRSQQENPCVFTVRVTGTVAHIDTASRNGKMVVRDDSGGSV
SVQLGPTLRGTDLRDSYKGVSYQDFNDQVLYGDFGRAINQQALAMIQASHPKVGDRLDVV
GVFSSWDIPQAVPDIMPAQITRDDKGG