Protein Info for DZA65_RS02240 in Dickeya dianthicola ME23

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF13412: HTH_24" amino acids 13 to 58 (46 residues), 23.2 bits, see alignment 8.2e-09 PF08279: HTH_11" amino acids 14 to 56 (43 residues), 29.7 bits, see alignment 9.9e-11 PF08220: HTH_DeoR" amino acids 14 to 68 (55 residues), 57.6 bits, see alignment E=1.7e-19 PF00455: DeoRC" amino acids 83 to 241 (159 residues), 144.6 bits, see alignment E=5.3e-46

Best Hits

KEGG orthology group: None (inferred from 97% identity to dze:Dd1591_3644)

Predicted SEED Role

"Unknown pentose utilization regulator, DeoR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSX6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS02240 DeoR/GlpR transcriptional regulator (Dickeya dianthicola ME23)
MKSKSEQLADMQQRREKILEMVREDGTVTVKMLTETFGLTEATIRTDLRELQKEGYVQRY
YGGATLVTGKQNTGALLLERQINLAEKDAIGRLAAAQIENGDTVIFDSGTTTTAIIEHMA
DIHRLSVITTAVNIALKLGGEPGINILLTGGTFKFPTLSTSGEKAAGFFENVLAEKLFLA
TAAISPRMGLSFPSETDIKVKSAMIRSAKTVYVVADSSKIGKVSMFALPCDWSNIHYLIT
DAGISQEAVSAFEALGVTVMVAN