Protein Info for DZA65_RS02120 in Dickeya dianthicola ME23

Annotation: site-specific integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF12834: Phage_int_SAM_2" amino acids 1 to 90 (90 residues), 131 bits, see alignment E=2.9e-42 PF02899: Phage_int_SAM_1" amino acids 15 to 85 (71 residues), 27.6 bits, see alignment E=4.3e-10 PF12835: Integrase_1" amino acids 102 to 250 (149 residues), 229.3 bits, see alignment E=2.8e-72

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddc:Dd586_3774)

Predicted SEED Role

"Phage DNA binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW08 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DZA65_RS02120 site-specific integrase (Dickeya dianthicola ME23)
MTKLSREMKTWAKQAGGSHKTVHDRLRIVERLCRHLLTLNIQVRSVQHVKARHIESYVAA
RRSQGMALRTLHNEMSALRSVLRLAGRGKLVDDPRLSNQALGLGGASRAGTKYAIPDALY
QSVLESARREDVGLACALQLARLLGLRSQEAVQCCASLKRWEQQLTRQADRLTVVFGTKG
GRPRETRVLDSAAVLAAVREALVIADNRNGKLINKPDLKTAMNFWRARTTRLGLTGHYSP
HSLRYAWAQDAMRFYLADGFSRQEARALVSMDLGHGDGRGRYVERVYTRQEEA