Protein Info for DZA65_RS02045 in Dickeya dianthicola ME23

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01078: arginine deiminase
  • amino acids 5 to 406 (402 residues), 529 bits, E=3.4e-163
• PF02274: ADI
  • amino acids 35 to 403 (369 residues), 443.2 bits, E=8e-137
• PF19420: DDAH_eukar
  • amino acids 150 to 276 (127 residues), 23.4 bits, E=3.4e-09

Best Hits

Swiss-Prot: 84% identical to ARCA_SALCH: Arginine deiminase (arcA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 97% identity to ddc:Dd586_0388)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

See A0A3A4CXH6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>DZA65_RS02045 arginine deiminase (Dickeya dianthicola ME23)
MQENYVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSVERAGKEHDIFSNLLRQ
QHVEVLLLTDLLTETLALPTAKSWLLDTQISDYRLGPSFAADIRGWLADQPHRQLARIMT
GGLTYSEIPETFSNMVVDTQKATDFIMSPLPNHLFTRDTSCWIYNGVSINPMAKSARQRE
TNNLRAIYRWHPRFAKGDFIKYFGDEDCNYDHATLEGGDVLVIGRGAVLIGMSERTTPQG
VEFLARALFHHQQASRVIALELPKHRACMHLDTVMTHIDVDTFSVYPEIVSKETQCWTLT
DDGHGGIKRREEPHFLTAIEQALNIDHVRLITTGGDQFEAEREQWNDANNVLTIRPGVVI
GYERNIWTNEKYDKAGITVLPIPGDELGRGRGGARCMSCPLERDAI