Protein Info for DZA65_RS02015 in Dickeya dianthicola ME23

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 63 to 323 (261 residues), 58.2 bits, see alignment E=1e-19 PF12697: Abhydrolase_6" amino acids 65 to 334 (270 residues), 29.5 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 93% identity to dze:Dd1591_3724)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVY9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>DZA65_RS02015 alpha/beta fold hydrolase (Dickeya dianthicola ME23)
MVNRLLSGLAGLAFLLVLSPFSTAQALQPQEGNWVAPEFRFHTGETINNLRIHYYTLGDS
KKPAVLLLHGTNQPIGALLAAGFGGELFGPGQPLDAGKYFIIIPESIGSGKSAKPSDGLR
TTFPQYNYDDMVLAQYRLLTEALGIKHLRLVMGYSMGGMHTWMWGEKYPDMMDALVPMAS
QPNELSGRNWMLRRMLIETIKHDPAWKNGDYTVQPPSLQTANIMFSIATTGGTLAYQNKA
PTRALADKLVDERLAAPVTADANDFIYIWNSSADYNASPELGRIRAPLLVINSADDERNP
IETGILESELKKIPRAELFLIPASKETSGHATMMSAKFYKNKLGEFLAAVPAHKQ