Protein Info for DZA65_RS02005 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13302: Acetyltransf_3" amino acids 10 to 144 (135 residues), 32.5 bits, see alignment E=2.8e-11 PF00583: Acetyltransf_1" amino acids 38 to 144 (107 residues), 76.7 bits, see alignment E=3.5e-25 PF13673: Acetyltransf_10" amino acids 57 to 147 (91 residues), 29.6 bits, see alignment E=1.2e-10 PF13508: Acetyltransf_7" amino acids 60 to 145 (86 residues), 57.4 bits, see alignment E=3.2e-19

Best Hits

Swiss-Prot: 71% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 93% identity to dze:Dd1591_3727)

MetaCyc: 71% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"Aspartate N-acetyltransferase (EC 2.3.1.17)" (EC 2.3.1.17)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CLD6 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DZA65_RS02005 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MTTSASTPLLTRPITAADNAAIASVIRRVSAEFSLTADKGYTVSDPDLDQLFELYSRPAS
AYWVVECNGEVVGGGGLAPLSGGEPDICELQKMYFLPLARGQGIARQLAKLALAFGREQG
FRRCYLETTAHLTSAIHLYEKLGFAHIPHALGNTGHVDCEVRMLKTL