Protein Info for DZA65_RS01970 in Dickeya dianthicola ME23

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00670: aspartate carbamoyltransferase
  • amino acids 8 to 305 (298 residues), 387.7 bits, E=1.7e-120
• PF02729: OTCace_N
  • amino acids 8 to 148 (141 residues), 158.5 bits, E=1.3e-50
• PF00185: OTCace
  • amino acids 155 to 303 (149 residues), 92.5 bits, E=3.1e-30

Best Hits

Swiss-Prot: 90% identical to PYRB_PECCP: Aspartate carbamoyltransferase (pyrB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 98% identity to ddd:Dda3937_01284)

MetaCyc: 84% identical to aspartate carbamoyltransferase catalytic subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.2

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

See A0A3A4CZP5 at UniProt or InterPro

Protein Sequence (311 amino acids)

>DZA65_RS01970 aspartate carbamoyltransferase (Dickeya dianthicola ME23)
MVNPLYKRHIISINDLSRDDLELTLKVAASLKARPQPELLKHKVIASCFFEASTRTRLSF
ETAIHRLGASVVGFADSNNTSLGKKGETLADTISVISNYVDAIVMRHPQEGAARLATEFS
GGVPVFNAGDGANQHPSQTLLDLFTIQETQGRLNNINIAMVGDLKYGRTVHSLTQALAKF
DGNRFYFISPDALAMPDYILNMLQEKGISYSLHTSIEEVAPQLDILYMTRVQKERLDPSE
YINIKSQFILRAADLGNARDNLKVLHPLPRIDEITTDVDSTPYAYYFQQAGNGIYARQAL
LALVLNSELVL