Protein Info for DZA65_RS01895 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 153 to 180 (28 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 299 to 325 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 20 to 114 (95 residues), 44.5 bits, see alignment E=1.6e-15 PF00528: BPD_transp_1" amino acids 129 to 330 (202 residues), 92.9 bits, see alignment E=2.1e-30

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 96% identity to ddd:Dda3937_01276)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT99 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DZA65_RS01895 ABC transporter permease (Dickeya dianthicola ME23)
MTIFHRWTGLKRWTGRCPLLMLILRRLLAGVAMVAVVSVLIFAGIQLLPGNAATAILGQT
ATPEAVRALNAQLGLDQPAFSRYLGWLWGVLGGDFGQSFSSRQSIAPVLAYRLENTLFLA
GCTAAVAVPLALLIGFLSVRYQGSWLDRLLNLFARVAVALPEFFSGYLLILIFSITLFWL
PSNSNVSDNMPPGARLAAIALPCMTLVLAVLGHMSNMTRAALIGAQNAAYVDTALLKGLS
PSAILLRHVLPNAWGPIINVIVLNLAYLMVGVVIVESVFVYPGLGQYMVDSISKRDMPVI
QGCALVLATIYILLNLLADVVSLMANPRLRHARR