Protein Info for DZA65_RS01850 in Dickeya dianthicola ME23

Annotation: carbohydrate porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF11471: Sugarporin_N" amino acids 26 to 56 (31 residues), 36.1 bits, see alignment (E = 6.1e-13) PF02264: LamB" amino acids 121 to 537 (417 residues), 322.1 bits, see alignment E=9.8e-100

Best Hits

Swiss-Prot: 63% identical to SCRY_KLEPN: Sucrose porin (scrY) from Klebsiella pneumoniae

KEGG orthology group: K02024, maltoporin (inferred from 96% identity to dze:Dd1591_3756)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT90 at UniProt or InterPro

Protein Sequence (537 amino acids)

>DZA65_RS01850 carbohydrate porin (Dickeya dianthicola ME23)
MKPGYLAAAVGLALCTAPALAAPSDSIEARLNALEQRLMQAEQRAKQAEARADAAEKQAK
QLAARTAQVEQKTQQVEQTTQQVAQQTQQVAARATQNEQQTQQVALKTDALTSKRSVADG
FEFHGYARSGLAIHDSVTSSKANIGPGLTPAGETGGYVGRLGNEDDTYLELKLEHRTKLD
NGATTRFKVMMADGQRSYNDWTASTSDLNVREAFVELGSLPTFTGAFKDTTLWAGKRFDR
DNFDIHWIDSDVVFLAGTGGGIYDVKPVDGWKTNLSLYGRSLGEITTLDNEIQNYIVTSN
NFVGPFQFMLSGLRARNNDIKENTGRNNADNVTNTNAGDNGYHALAAWHGDSFYGLRDGT
SKVALLYGHGLGGEVKSIGSDGNLTQNANTWRLATYGTTALNKTWSFAPAILAQTSKDRY
VQGDDYRWATFNARFIQEITENFALAYEGSYQYMNLEPQGYLSRNQVSGGFYKLTFAPTF
KVGDISNLLSRPELRVFASYMDWDKRLDNYASDDAFGSTGFKAGGEWTFGVQMETWF