Protein Info for DZA65_RS01775 in Dickeya dianthicola ME23

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF06719: AraC_N" amino acids 27 to 179 (153 residues), 147.4 bits, see alignment E=3.8e-47 PF00165: HTH_AraC" amino acids 203 to 242 (40 residues), 35 bits, see alignment 1.8e-12 PF12833: HTH_18" amino acids 214 to 289 (76 residues), 74.9 bits, see alignment E=7.4e-25

Best Hits

Swiss-Prot: 59% identical to YQHC_ECOLI: Uncharacterized HTH-type transcriptional regulator YqhC (yqhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_01259)

Predicted SEED Role

"Hypothetical transcriptional regulator YqhC" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSJ3 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DZA65_RS01775 AraC family transcriptional regulator (Dickeya dianthicola ME23)
MQNLSSRQHLVNLAMLYAAGNGVSQTPIPQVKVIYIDRHGVRAPVLYDPCIVIIFQGHKV
GYLGDKVFQYDPDNYLLMTVPLPFECESFASSENPLVGISIRVDIPILQDLLIDMGDDSC
SEKRRADAAGINSVPLNEAILCATARLLEAMANARDARVLGPWIVREILYHILCGPCGDS
LQALMNRYSHFSQIARALRYIENYYADNLSVERLAMEVNMSVSAFHHNFKAVTNTSPVQY
LKSYRLHKARLLMVHDGLKANAASIQVGYESSSQFSREFKRFFGVTPGDEVARLRSGSGV
VESS