Protein Info for DZA65_RS01750 in Dickeya dianthicola ME23

Annotation: DNA topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 9 to 743 (735 residues), 1295 bits, see alignment E=0 PF00521: DNA_topoisoIV" amino acids 33 to 469 (437 residues), 487.2 bits, see alignment E=4.7e-150 PF03989: DNA_gyraseA_C" amino acids 597 to 634 (38 residues), 12 bits, see alignment 1.2e-05 amino acids 645 to 696 (52 residues), 23.7 bits, see alignment 2.5e-09

Best Hits

Swiss-Prot: 80% identical to PARC_ECO57: DNA topoisomerase 4 subunit A (parC) from Escherichia coli O157:H7

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 98% identity to ddd:Dda3937_01254)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT59 at UniProt or InterPro

Protein Sequence (758 amino acids)

>DZA65_RS01750 DNA topoisomerase IV subunit A (Dickeya dianthicola ME23)
MSDMTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLSA
SAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFA
AMRYTESRLSKYAEVLLGELGQGTVDYVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGM
ATDIPPHNVREVAAAAMALIDEPDTQLDALLRHVQGPDFPTEAEIITPRDEIRKMYESGR
GSVRMRAVWKKEDGSVVITALPHQVSGARVLEQIASQMRAKKLPMLDDLRDESDHENPTR
LVLVPRSNRIDFDQVMNHLFATTDLEKSYRINMNMIGLDGRPSVKGLREILTEWLAFRRD
TVRRRLNFRLDKVLKRLHILEGLLIAFLNIDDVIHIIRNEDEPKPVLMAKFGLSDTQAEA
ILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASERKMNTLLKKEIQEDAKAYGDER
RSPLHERGEAKAMSEHDLSPSEPVTIVLSEMGWVRSAKGHDIDPSGLSYKAGDAYRAAAR
GKSNQPVVFMDSTGRSYALDPLTLPSARGQGEPLTGKLTLPPGATIEQVLMAADNQRLLL
ASDAGYGFICTFADLVARNRVGKAVLTLPDHSRVLAPLELQRDDDLLLTVTAAGRMLLFP
VADLPELSKGKGNKIVSIPAAQLASGDDRILWLMAISPHSSVTLYAGKRKYSLRPEELQK
YQASRGCKGTALPRGLQRVDRIEVDAPAGIASADSSEE