Protein Info for DZA65_RS01745 in Dickeya dianthicola ME23

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF02525: Flavodoxin_2" amino acids 3 to 190 (188 residues), 123.9 bits, see alignment E=3.5e-40

Best Hits

Swiss-Prot: 70% identical to MDAB_ECO57: Modulator of drug activity B (mdaB) from Escherichia coli O157:H7

KEGG orthology group: K03923, modulator of drug activity B (inferred from 97% identity to ddd:Dda3937_01253)

MetaCyc: 70% identical to NADPH:quinone oxidoreductase MdaB (Escherichia coli K-12 substr. MG1655)
RXN0-271 [EC: 1.6.5.10]

Predicted SEED Role

"Modulator of drug activity B"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSK1 at UniProt or InterPro

Protein Sequence (193 amino acids)

>DZA65_RS01745 NAD(P)H-dependent oxidoreductase (Dickeya dianthicola ME23)
MHNVLIINAGKSFSHSKGELNRTLTDVAASFLRDKGRHVRITTVDEGYDIEQEVQNFLWA
DAIIYQMPGWWMGAPWILKKYIDEVFTAGHDSLYASDGRTRADESKKYGSGGLLQGKHYL
LSLTWNAPLEAFTDPDQFFHGVGVDGVYLPFHKANQFIGLSSLPTFICNDVVKQPDVEQD
IARYRAHLDQVFA