Protein Info for DZA65_RS01545 in Dickeya dianthicola ME23

Annotation: phospholipid ABC transporter ATP-binding protein MlaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00005: ABC_tran" amino acids 23 to 170 (148 residues), 104.6 bits, see alignment E=6.7e-34

Best Hits

Swiss-Prot: 81% identical to MLAF_ECOLI: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Escherichia coli (strain K12)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 98% identity to ddd:Dda3937_00689)

Predicted SEED Role

"Uncharacterized ABC transporter, ATP-binding protein YrbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT27 at UniProt or InterPro

Protein Sequence (269 amino acids)

>DZA65_RS01545 phospholipid ABC transporter ATP-binding protein MlaF (Dickeya dianthicola ME23)
MNHENLVEIRGLSFRRGNRPIFSDVSLNVPKQKITAIMGPSGIGKTTLLRLIGGQLQPDS
GEIWFDGENIPILPRSHLYETRKKMSMLFQSGALFTDLNVFDNVAWPLREHTQLPEALLH
STVMMKLEAVGLRGAAELMPSELSGGMARRAALARAIALDPQMIMFDEPFVGQDPITMGV
LVKLIDELNHALGVTCIVVSHDVPEVLSIADYAYIIADQRVVAEGSPAELQCNGDPRVRQ
FLDGIADGPVPFRYPAGDYQRGLLGLGSK