Protein Info for DZA65_RS01540 in Dickeya dianthicola ME23

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 2 to 312 (311 residues), 287.3 bits, see alignment E=6.6e-90 PF01699: Na_Ca_ex" amino acids 4 to 143 (140 residues), 113.9 bits, see alignment E=3.5e-37 amino acids 175 to 317 (143 residues), 118.4 bits, see alignment E=1.4e-38

Best Hits

Swiss-Prot: 59% identical to YRBG_ECOLI: Inner membrane protein YrbG (yrbG) from Escherichia coli (strain K12)

KEGG orthology group: K07301, inner membrane protein (inferred from 98% identity to ddd:Dda3937_00688)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7E9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DZA65_RS01540 calcium/sodium antiporter (Dickeya dianthicola ME23)
MLFATVLLIVGLVLLVYGADRLVYGAAVLARTFGVPPMIIGMTIVGMGTSLPELMVSVTA
ALNHQTDMAVGNVLGSNIANILLILGSAVLIRPLTLHSTLLRQELPPMLVVTLLCGILLH
DSVLSRLDGVILLLTAGGCIVLMLRMAHAAQNRGDDSLTREQMAELPRENNQTVALLWLL
LGLIILPMSARIVIDNATVIANYFNISELTIGLTVLAVGTSLPELATAVVGTLKKEDDIA
LGNLIGSNIFNIVIVLGVPALLSPGAVNPLAFARDYWVMLGVSALLTVLCLRQKRRIGQG
AGALLLCAFIAYLSVLFLFS