Protein Info for DZA65_RS01500 in Dickeya dianthicola ME23

Annotation: PTS IIA-like nitrogen regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 8 to 155 (148 residues), 199 bits, E=1.7e-63
• PF00359: PTS_EIIA_2
  • amino acids 12 to 155 (144 residues), 121.6 bits, E=1.3e-39

Best Hits

Swiss-Prot: 83% identical to PTSN_ECOLI: Nitrogen regulatory protein (ptsN) from Escherichia coli (strain K12)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 99% identity to ddd:Dda3937_00680)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See A0A385XT36 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DZA65_RS01500 PTS IIA-like nitrogen regulatory protein PtsN (Dickeya dianthicola ME23)
MNNEPVMQLSAVLRKECTRSAVHCQSKKRALEIISELAARQLNLPPQMVFEAILTRERMG
STGIGNGIAIPHGKLEDENTLGAVGVFIQLEQPIAFDAIDNQPVDLLFALLVPTEQCKTH
LHTLSLVAKRLADKTVCKRLRAAQSDEELYQIMTEADLSDQP