Protein Info for DZA65_RS01420 in Dickeya dianthicola ME23

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF04093: MreD" amino acids 7 to 155 (149 residues), 151.7 bits, see alignment E=9.5e-49 TIGR03426: rod shape-determining protein MreD" amino acids 9 to 154 (146 residues), 137.9 bits, see alignment E=1.3e-44

Best Hits

Swiss-Prot: 75% identical to MRED_ECO57: Rod shape-determining protein MreD (mreD) from Escherichia coli O157:H7

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 96% identity to dze:Dd1591_3833)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CL36 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DZA65_RS01420 rod shape-determining protein MreD (Dickeya dianthicola ME23)
MNSYRGHGHWIIWLSFLVAMVLQIMPWPDDLYMYRPSWLTLILIYWVMALPHRVNVGTGF
VLGMITDLILGSTLGVRALGLSIIAYLVAFKFQLFRNMALWQQALIVMLLSLVLDLLVFW
AEFLVINVSLRPEIFWNSVVDGILWPWLFLLMRKIRRRFAVQ